PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016651550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family B3
Protein Properties Length: 605aa    MW: 69623.3 Da    PI: 9.8131
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016651550.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.21.3e-1226113699
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     +p+ ++    l++pkkf++++g +   s  + l+ ++g +W+++l  r+  g+ ++ kGW eF +   L+   ++vF ++g+s+f  ++ +f++
  XP_016651550.1  26 IPKGTSGDIKLSIPKKFLRKYGDD--LSNPVLLKLPNGSKWNIEL--RRWEGEAWFDKGWPEFSEFYFLEHCHSLVFGYEGNSKF--HICIFDE 113
                     55556666789**********988..66679999***********..88888899**************************9999..9999986 PP

2B340.64.7e-132523321699
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++l  +f   +g+ +++s  ++l d+ gr W v++    k++   +++GW eFv+ n+L+++D++vF l+++++  + v +fr+
  XP_016651550.1 252 MWLTSDFSILMGHLSKNSANVILWDLGGRAWVVEF--IAKPR-AKFQSGWHEFVRGNNLNVNDVCVFVLIDDTRLVFEVVIFRA 332
                     66666665555555557788***************..55554.469************************99998888888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-1914114IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-1915113IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.06921114IPR003340B3 DNA binding domain
SMARTSM010193.7E-822114IPR003340B3 DNA binding domain
CDDcd100176.14E-1425112No hitNo description
PfamPF023624.8E-1025113IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.9E-17230332IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-16231331IPR015300DNA-binding pseudobarrel domain
CDDcd100172.65E-13236331No hitNo description
PROSITE profilePS5086311.068237333IPR003340B3 DNA binding domain
SMARTSM010191.5E-6238333IPR003340B3 DNA binding domain
PfamPF023624.3E-11248332IPR003340B3 DNA binding domain
CDDcd100173.31E-6357453No hitNo description
SMARTSM010190.027361456IPR003340B3 DNA binding domain
SuperFamilySSF1019361.86E-9407458IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.5E-8408458IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.275408456IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-9532595IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-9533595IPR015300DNA-binding pseudobarrel domain
CDDcd100174.35E-6539590No hitNo description
PROSITE profilePS508637.57539605IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MNSPRREIGN PTKTFSSSTP HFLMMIPKGT SGDIKLSIPK KFLRKYGDDL SNPVLLKLPN  60
GSKWNIELRR WEGEAWFDKG WPEFSEFYFL EHCHSLVFGY EGNSKFHICI FDESFIEIEY  120
PLTMPEMKET DADDDSSDES DDHSDDASLE ILDKFPPCPR KSKGKSSFPC PRPHKKKRTS  180
SSGNVDFPSK RHDRGTSSTP RFLKRTQVVR GRRHPLTTSG KALALQRAKA YKSDKPSFIV  240
PMHRSYIGRH PMWLTSDFSI LMGHLSKNSA NVILWDLGGR AWVVEFIAKP RAKFQSGWHE  300
FVRGNNLNVN DVCVFVLIDD TRLVFEVVIF RAVQAANCTL LPDVDGEETE EDDDSALPAK  360
FVKEHLNQAH DKAVLRVSDE RTCKSHQHFS CILMVEKYLR SPTFGPPVNV KKADDKFFFQ  420
KGWKKFVHDR VLKLCEFLVF GYAGNLGFYV DIYGRDGCKK KFVTAIRERG RRHHEEGHGN  480
VIHRRSPRHH GKQNLPSIDP IKYEATDTES ETSMHPLATS TGKTIALPRN NSFNSEKPFF  540
KSAIQNSYIR RGYMYLPRNF GRTHLTEQRA TVTLRVSDGK TWPVKLAIEG ERAKLRWWFH  600
DILPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007203051.10.0hypothetical protein PRUPE_ppa022948mg
TrEMBLM5WBU90.0M5WBU9_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-31B3 family protein